Lineage for d4jylf_ (4jyl F:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2852293Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2852294Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2853595Family c.14.1.0: automated matches [191346] (1 protein)
    not a true family
  6. 2853596Protein automated matches [190246] (71 species)
    not a true protein
  7. 2854389Species Thermoplasma volcanium [TaxId:273116] [226642] (1 PDB entry)
  8. 2854395Domain d4jylf_: 4jyl F: [224084]
    Other proteins in same PDB: d4jyla2, d4jylb2, d4jylc2, d4jyld2, d4jyle2
    automated match to d2duba_
    complexed with cl, so4

Details for d4jylf_

PDB Entry: 4jyl (more details), 2.37 Å

PDB Description: crystal structure of enoyl-coa hydratase from thermoplasma volcanium gss1
PDB Compounds: (F:) enoyl-coa hydratase

SCOPe Domain Sequences for d4jylf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4jylf_ c.14.1.0 (F:) automated matches {Thermoplasma volcanium [TaxId: 273116]}
mlveierrgdaslivlsrpeklnainlemladladqfskaekedtrvivitgygknfsag
adinmlasfdpasaysfrlkmnsiaqrirksdkpviallkgysmggglelaesadiriam
sdavigqpessiginagaggnvilpklvgrgsaaylamsgkklnaqeamalglvdevvdd
eakawkiiddickkpkktlqfikrainssydmglesamdqealyfsllftdpevldalsk
wr

SCOPe Domain Coordinates for d4jylf_:

Click to download the PDB-style file with coordinates for d4jylf_.
(The format of our PDB-style files is described here.)

Timeline for d4jylf_: