Lineage for d1c7sa2 (1c7s A:28-200)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 10320Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (7 superfamilies)
  4. 10334Superfamily b.2.2: Carbohydrate-binding domain [49384] (3 families) (S)
  5. 10368Family b.2.2.3: Bacterial chitobiase, n-terminal domain [49398] (1 protein)
  6. 10369Protein Bacterial chitobiase, n-terminal domain [49399] (1 species)
  7. 10370Species Serratia marcescens [TaxId:615] [49400] (4 PDB entries)
  8. 10372Domain d1c7sa2: 1c7s A:28-200 [22408]
    Other proteins in same PDB: d1c7sa1, d1c7sa3, d1c7sa4

Details for d1c7sa2

PDB Entry: 1c7s (more details), 1.8 Å

PDB Description: beta-n-acetylhexosaminidase mutant d539a complexed with di-n-acetyl- beta-d-glucosamine (chitobiase)

SCOP Domain Sequences for d1c7sa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c7sa2 b.2.2.3 (A:28-200) Bacterial chitobiase, n-terminal domain {Serratia marcescens}
dqqlvdqlsqlklnvkmldnragengvdcaalgadwascnrvlftlsndgqaidgkdwvi
yfhsprqtlrvdndqfkiahltgdlykleptakfsgfpagkaveipvvaeywqlfrndfl
prwyatsgdakpkmlantdtenldqfvapftgdqwkrtkddknilmtpasrfv

SCOP Domain Coordinates for d1c7sa2:

Click to download the PDB-style file with coordinates for d1c7sa2.
(The format of our PDB-style files is described here.)

Timeline for d1c7sa2: