SCOPe 2.04: Domain d4jyla_: 4jyl A:

Lineage for d4jyla_ (4jyl A:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.14: ClpP/crotonase [52095] (1 superfamily)
   core: 4 turns of (beta-beta-alpha)n superhelix

4. Superfamily c.14.1: ClpP/crotonase [52096] (5 families)

5. Family c.14.1.0: automated matches [191346] (1 protein)
   not a true family

6. Protein automated matches [190246] (46 species)
   not a true protein

7. Species Thermoplasma volcanium [TaxId:273116] [226642] (1 PDB entry)

8. Domain d4jyla_: 4jyl A: [224079]
   automated match to d2duba_
   complexed with cl, so4

Details for d4jyla_

PDB Entry: 4jyl, 2.37 Å

PDB Description: crystal structure of enoyl-coa hydratase from thermoplasma volcanium gss1

PDB Compounds: (A:) enoyl-coa hydratase

SCOPe Domain Sequences for d4jyla_:

Sequence; same for both SEQRES and ATOM records:

>d4jyla_ c.14.1.0 (A:) automated matches {Thermoplasma volcanium [TaxId: 273116]}
nlyfqsmlveierrgdaslivlsrpeklnainlemladladqfskaekedtrvivitgyg
knfsagadinmlasfdpasaysfrlkmnsiaqrirksdkpviallkgysmggglelaesa
diriamsdavigqpessiginagaggnvilpklvgrgsaaylamsgkklnaqeamalglv
devvddeakawkiiddickkpkktlqfikrainssydmglesamdqealyfsllftdpev
ldalskwrk

Timeline for d4jyla_:

• d4jyla_ first appeared in SCOPe 2.03
  
• d4jyla_ appears in SCOPe 2.05
  
• d4jyla_ appears in the current release, SCOPe 2.08, called d4jyla1