SCOPe 2.03: Domain d4jykb2: 4jyk B:87-212

Lineage for d4jykb2 (4jyk B:87-212)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
   multihelical; interlocked (homo)dimer

4. Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families)

5. Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (35 proteins)

6. Protein Hypothetical transcriptional regulator YcdC [89136] (1 species)

7. Species Escherichia coli [TaxId:562] [89137] (2 PDB entries)

8. Domain d4jykb2: 4jyk B:87-212 [224078]
   Other proteins in same PDB: d4jyka1, d4jykb1
   automated match to d3loca2
   complexed with so4, ura

Details for d4jykb2

PDB Entry: 4jyk, 1.7 Å

PDB Description: structure of e. coli transcriptional regulator rutr with bound uracil

PDB Compounds: (B:) HTH-type transcriptional regulator rutR

SCOPe Domain Sequences for d4jykb2:

Sequence; same for both SEQRES and ATOM records:

>d4jykb2 a.121.1.1 (B:87-212) Hypothetical transcriptional regulator YcdC {Escherichia coli [TaxId: 562]}
dfaplaaikeyirlklevsrdypqasrlfcmemlagapllmdeltgdlkalideksalia
gwvksgklapidpqhlifmiwastqhyadfapqveavtgatlrdevffnqtvenvqriii
egirpr

Timeline for d4jykb2:

• d4jykb2 is new in SCOPe 2.03-stable
  
• d4jykb2 appears in SCOPe 2.04
  
• d4jykb2 appears in the current release, SCOPe 2.08