Class a: All alpha proteins [46456] (284 folds) |
Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily) multihelical; interlocked (homo)dimer |
Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families) |
Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (35 proteins) |
Protein Hypothetical transcriptional regulator YcdC [89136] (1 species) |
Species Escherichia coli [TaxId:562] [89137] (2 PDB entries) |
Domain d4jykb2: 4jyk B:87-212 [224078] Other proteins in same PDB: d4jyka1, d4jykb1 automated match to d3loca2 complexed with so4, ura |
PDB Entry: 4jyk (more details), 1.7 Å
SCOPe Domain Sequences for d4jykb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4jykb2 a.121.1.1 (B:87-212) Hypothetical transcriptional regulator YcdC {Escherichia coli [TaxId: 562]} dfaplaaikeyirlklevsrdypqasrlfcmemlagapllmdeltgdlkalideksalia gwvksgklapidpqhlifmiwastqhyadfapqveavtgatlrdevffnqtvenvqriii egirpr
Timeline for d4jykb2: