Lineage for d4jykb2 (4jyk B:87-212)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2727850Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
    multihelical; interlocked (homo)dimer
  4. 2727851Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families) (S)
  5. 2727852Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (35 proteins)
  6. 2727945Protein Hypothetical transcriptional regulator YcdC [89136] (1 species)
  7. 2727946Species Escherichia coli [TaxId:562] [89137] (4 PDB entries)
  8. 2727948Domain d4jykb2: 4jyk B:87-212 [224078]
    Other proteins in same PDB: d4jyka1, d4jykb1
    automated match to d3loca2
    complexed with so4, ura

Details for d4jykb2

PDB Entry: 4jyk (more details), 1.7 Å

PDB Description: structure of e. coli transcriptional regulator rutr with bound uracil
PDB Compounds: (B:) HTH-type transcriptional regulator rutR

SCOPe Domain Sequences for d4jykb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4jykb2 a.121.1.1 (B:87-212) Hypothetical transcriptional regulator YcdC {Escherichia coli [TaxId: 562]}
dfaplaaikeyirlklevsrdypqasrlfcmemlagapllmdeltgdlkalideksalia
gwvksgklapidpqhlifmiwastqhyadfapqveavtgatlrdevffnqtvenvqriii
egirpr

SCOPe Domain Coordinates for d4jykb2:

Click to download the PDB-style file with coordinates for d4jykb2.
(The format of our PDB-style files is described here.)

Timeline for d4jykb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4jykb1