SCOPe 2.06: Domain d4jykb1: 4jyk B:17-86

Lineage for d4jykb1 (4jyk B:17-86)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.1: Homeodomain-like [46689] (20 families)
   consists only of helices

5. Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (35 proteins)

6. Protein Hypothetical transcriptional regulator YcdC [88973] (1 species)

7. Species Escherichia coli [TaxId:562] [88974] (4 PDB entries)

8. Domain d4jykb1: 4jyk B:17-86 [224077]
   Other proteins in same PDB: d4jyka2, d4jykb2
   automated match to d3loca1
   complexed with so4, ura

Details for d4jykb1

PDB Entry: 4jyk, 1.7 Å

PDB Description: structure of e. coli transcriptional regulator rutr with bound uracil

PDB Compounds: (B:) HTH-type transcriptional regulator rutR

SCOPe Domain Sequences for d4jykb1:

Sequence; same for both SEQRES and ATOM records:

>d4jykb1 a.4.1.9 (B:17-86) Hypothetical transcriptional regulator YcdC {Escherichia coli [TaxId: 562]}
sakkkailsaaldtfsqfgfhgtrleqiaelagvsktnllyyfpskealyiavlrqildi
wlaplkafre

Timeline for d4jykb1:

• d4jykb1 first appeared in SCOPe 2.03
  
• d4jykb1 appears in SCOPe 2.05
  
• d4jykb1 appears in SCOPe 2.07
  
• d4jykb1 appears in the current release, SCOPe 2.08