| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.1: Homeodomain-like [46689] (21 families) ![]() consists only of helices |
| Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (35 proteins) |
| Protein Hypothetical transcriptional regulator YcdC [88973] (1 species) |
| Species Escherichia coli [TaxId:562] [88974] (4 PDB entries) |
| Domain d4jykb1: 4jyk B:17-86 [224077] Other proteins in same PDB: d4jyka2, d4jykb2 automated match to d3loca1 complexed with so4, ura |
PDB Entry: 4jyk (more details), 1.7 Å
SCOPe Domain Sequences for d4jykb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4jykb1 a.4.1.9 (B:17-86) Hypothetical transcriptional regulator YcdC {Escherichia coli [TaxId: 562]}
sakkkailsaaldtfsqfgfhgtrleqiaelagvsktnllyyfpskealyiavlrqildi
wlaplkafre
Timeline for d4jykb1: