Lineage for d4jyka1 (4jyk A:12-86)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1981563Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1981564Superfamily a.4.1: Homeodomain-like [46689] (20 families) (S)
    consists only of helices
  5. 1981994Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (35 proteins)
  6. 1982042Protein Hypothetical transcriptional regulator YcdC [88973] (1 species)
  7. 1982043Species Escherichia coli [TaxId:562] [88974] (4 PDB entries)
  8. 1982044Domain d4jyka1: 4jyk A:12-86 [224075]
    Other proteins in same PDB: d4jyka2, d4jykb2
    automated match to d3loca1
    complexed with so4, ura

Details for d4jyka1

PDB Entry: 4jyk (more details), 1.7 Å

PDB Description: structure of e. coli transcriptional regulator rutr with bound uracil
PDB Compounds: (A:) HTH-type transcriptional regulator rutR

SCOPe Domain Sequences for d4jyka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4jyka1 a.4.1.9 (A:12-86) Hypothetical transcriptional regulator YcdC {Escherichia coli [TaxId: 562]}
rsravsakkkailsaaldtfsqfgfhgtrleqiaelagvsktnllyyfpskealyiavlr
qildiwlaplkafre

SCOPe Domain Coordinates for d4jyka1:

Click to download the PDB-style file with coordinates for d4jyka1.
(The format of our PDB-style files is described here.)

Timeline for d4jyka1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4jyka2