SCOPe 2.05: Domain d4jy6a1: 4jy6 A:8-111

Lineage for d4jy6a1 (4jy6 A:8-111)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (26 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (558 PDB entries)

8. Domain d4jy6a1: 4jy6 A:8-111 [224071]
   automated match to d1etza1
   complexed with gol, zn

Details for d4jy6a1

PDB Entry: 4jy6, 2.5 Å

PDB Description: Crystal structure of human Fab PGT123, a broadly reactive and potent HIV-1 neutralizing antibody

PDB Compounds: (A:) PGT123 light chain

SCOPe Domain Sequences for d4jy6a1:

Sequence; same for both SEQRES and ATOM records:

>d4jy6a1 b.1.1.0 (A:8-111) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ssmsvspgetakiscgkesigsravqwyqqkpgqppsliiynnqdrpagvperfsaspdf
rpgttatltitnvdaedeadyychiydarggtnwvfdrgttltvlg

Timeline for d4jy6a1:

• d4jy6a1 first appeared in SCOPe 2.03
  
• d4jy6a1 appears in SCOPe 2.04
  
• d4jy6a1 appears in SCOPe 2.06
  
• d4jy6a1 appears in the current release, SCOPe 2.08