SCOPe 2.03: Domain d4jy5l2: 4jy5 L:109-209

Lineage for d4jy5l2 (4jy5 L:109-209)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (12 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (293 PDB entries)

8. Domain d4jy5l2: 4jy5 L:109-209 [224070]
   Other proteins in same PDB: d4jy5l1
   automated match to d1adql2
   complexed with gol

Details for d4jy5l2

PDB Entry: 4jy5, 1.75 Å

PDB Description: Crystal structure of human Fab PGT122, a broadly reactive and potent HIV-1 neutralizing antibody

PDB Compounds: (L:) PGT122 light chain

SCOPe Domain Sequences for d4jy5l2:

Sequence, based on SEQRES records:

>d4jy5l2 b.1.1.2 (L:109-209) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qpkaapsvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskq
snnkyaassylsltpeqwkshksyscqvthegstvektvap

Sequence, based on observed residues (ATOM records):

>d4jy5l2 b.1.1.2 (L:109-209) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qaapsvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskyaa
ssylsltpeqwkshksyscqvthegstvektvap

Timeline for d4jy5l2:

• d4jy5l2 is new in SCOPe 2.03-stable
  
• d4jy5l2 appears in SCOPe 2.04
  
• d4jy5l2 appears in the current release, SCOPe 2.08