Lineage for d4jy5l2 (4jy5 L:109-209)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2749887Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)
  8. 2750057Domain d4jy5l2: 4jy5 L:109-209 [224070]
    Other proteins in same PDB: d4jy5h_, d4jy5l1
    automated match to d1adql2
    complexed with gol

Details for d4jy5l2

PDB Entry: 4jy5 (more details), 1.75 Å

PDB Description: Crystal structure of human Fab PGT122, a broadly reactive and potent HIV-1 neutralizing antibody
PDB Compounds: (L:) PGT122 light chain

SCOPe Domain Sequences for d4jy5l2:

Sequence, based on SEQRES records: (download)

>d4jy5l2 b.1.1.2 (L:109-209) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qpkaapsvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskq
snnkyaassylsltpeqwkshksyscqvthegstvektvap

Sequence, based on observed residues (ATOM records): (download)

>d4jy5l2 b.1.1.2 (L:109-209) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qaapsvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskyaa
ssylsltpeqwkshksyscqvthegstvektvap

SCOPe Domain Coordinates for d4jy5l2:

Click to download the PDB-style file with coordinates for d4jy5l2.
(The format of our PDB-style files is described here.)

Timeline for d4jy5l2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4jy5l1
View in 3D
Domains from other chains:
(mouse over for more information)
d4jy5h_