Lineage for d4jy4a2 (4jy4 A:109-211)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2355236Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2355237Protein automated matches [190740] (24 species)
    not a true protein
  7. 2355363Species Human (Homo sapiens) [TaxId:9606] [187920] (1030 PDB entries)
  8. 2356791Domain d4jy4a2: 4jy4 A:109-211 [224068]
    automated match to d1etza2
    complexed with gol

Details for d4jy4a2

PDB Entry: 4jy4 (more details), 2.8 Å

PDB Description: Crystal structure of human Fab PGT121, a broadly reactive and potent HIV-1 neutralizing antibody
PDB Compounds: (A:) PGT121 light chain

SCOPe Domain Sequences for d4jy4a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4jy4a2 b.1.1.0 (A:109-211) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qpkaapsvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskq
snnkyaassylsltpeqwkshksyscqvthegstvektvapte

SCOPe Domain Coordinates for d4jy4a2:

Click to download the PDB-style file with coordinates for d4jy4a2.
(The format of our PDB-style files is described here.)

Timeline for d4jy4a2: