SCOPe 2.08: Domain d4jy4a1: 4jy4 A:9-108

Lineage for d4jy4a1 (4jy4 A:9-108)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d4jy4a1: 4jy4 A:9-108 [224067]
   automated match to d1etza1
   complexed with gol

Details for d4jy4a1

PDB Entry: 4jy4, 2.8 Å

PDB Description: crystal structure of human fab pgt121, a broadly reactive and potent hiv-1 neutralizing antibody

PDB Compounds: (A:) PGT121 light chain

SCOPe Domain Sequences for d4jy4a1:

Sequence; same for both SEQRES and ATOM records:

>d4jy4a1 b.1.1.0 (A:9-108) automated matches {Human (Homo sapiens) [TaxId: 9606]}
disvapgetariscgekslgsravqwyqhragqapsliiynnqdrpsgiperfsgspdsp
fgttatltitsveagdeadyychiwdsrvptkwvfgggttltvlg

Timeline for d4jy4a1:

• d4jy4a1 first appeared in SCOPe 2.03
  
• d4jy4a1 appears in SCOPe 2.07