Lineage for d4jxxa2 (4jxx A:339-548)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1798714Fold b.53: Ribosomal protein L25-like [50714] (1 superfamily)
    barrel, closed; n=6, S=10; complex topology
  4. 1798715Superfamily b.53.1: Ribosomal protein L25-like [50715] (3 families) (S)
  5. 1798777Family b.53.1.2: Gln-tRNA synthetase (GlnRS), C-terminal (anticodon-binding) domain [50719] (1 protein)
    automatically mapped to Pfam PF03950
  6. 1798778Protein Gln-tRNA synthetase (GlnRS), C-terminal (anticodon-binding) domain [50720] (2 species)
    duplication, consists of two barrel domains with the swapping of N-terminal strands
  7. 1798781Species Escherichia coli [TaxId:562] [50721] (17 PDB entries)
  8. 1798791Domain d4jxxa2: 4jxx A:339-548 [224066]
    Other proteins in same PDB: d4jxxa1
    automated match to d1gtra1
    protein/RNA complex; complexed with atp, so4

Details for d4jxxa2

PDB Entry: 4jxx (more details), 2.3 Å

PDB Description: Crystal structure of E coli E. coli glutaminyl-tRNA synthetase bound to tRNA(Gln)(CUG) and ATP from novel cryostabilization conditions
PDB Compounds: (A:) Glutamine--tRNA ligase

SCOPe Domain Sequences for d4jxxa2:

Sequence, based on SEQRES records: (download)

>d4jxxa2 b.53.1.2 (A:339-548) Gln-tRNA synthetase (GlnRS), C-terminal (anticodon-binding) domain {Escherichia coli [TaxId: 562]}
apramavidpvklvienyqgegemvtmpnhpnkpemgsrqvpfsgeiwidradfreeank
qykrlvlgkevrlrnayvikaervekdaegnittifctydadtlskdpadgrkvkgvihw
vsaahalpveirlydrlfsvpnpgaaddflsvinpeslvikqgfaepslkdavagkafqf
eregyfcldsrhstaekpvfnrtvglrdtw

Sequence, based on observed residues (ATOM records): (download)

>d4jxxa2 b.53.1.2 (A:339-548) Gln-tRNA synthetase (GlnRS), C-terminal (anticodon-binding) domain {Escherichia coli [TaxId: 562]}
apramavidpvklvienyqgegemvtmpnhpnkpemgsrqvpfsgeiwidradfreeank
qykrlvlgkevrlrnayvikaervekdaegnittifctydadtlsrkvkgvihwvsaaha
lpveirlydrlfsvpnpgaaddflsvinpeslvikqgfaepslkdavagkafqferegyf
cldsrhstaekpvfnrtvglrdtw

SCOPe Domain Coordinates for d4jxxa2:

Click to download the PDB-style file with coordinates for d4jxxa2.
(The format of our PDB-style files is described here.)

Timeline for d4jxxa2: