SCOPe 2.03: Domain d4jxxa1: 4jxx A:7-338

Lineage for d4jxxa1 (4jxx A:7-338)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
   core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families)

5. Family c.26.1.1: Class I aminoacyl-tRNA synthetases (RS), catalytic domain [52375] (13 proteins)
   contains a conserved all-alpha subdomain at the C-terminal extension

6. Protein Glutaminyl-tRNA synthetase (GlnRS) [52380] (2 species)

7. Species Escherichia coli [TaxId:562] [52381] (17 PDB entries)

8. Domain d4jxxa1: 4jxx A:7-338 [224065]
   Other proteins in same PDB: d4jxxa2
   automated match to d1gtra2
   protein/RNA complex; complexed with atp, so4

Details for d4jxxa1

PDB Entry: 4jxx, 2.3 Å

PDB Description: Crystal structure of E coli E. coli glutaminyl-tRNA synthetase bound to tRNA(Gln)(CUG) and ATP from novel cryostabilization conditions

PDB Compounds: (A:) Glutamine--tRNA ligase

SCOPe Domain Sequences for d4jxxa1:

Sequence; same for both SEQRES and ATOM records:

>d4jxxa1 c.26.1.1 (A:7-338) Glutaminyl-tRNA synthetase (GlnRS) {Escherichia coli [TaxId: 562]}
ptnfirqiidedlasgkhttvhtrfppepngylhighaksiclnfgiaqdykgqcnlrfd
dtnpvkedieyvesikndvewlgfhwsgnvryssdyfdqlhayaielinkglayvdeltp
eqireyrgtltqpgknspyrdrsveenlalfekmraggfeegkaclrakidmaspfivmr
dpvlyrikfaehhqtgnkwciypmydfthcisdalegithslctlefqdnrrlydwvldn
itipvhprqyefsrlnleytvmskrklnllvtdkhvegwddprmptisglrrrgytaasi
refckrigvtkqdntiemaslesciredlnen

Timeline for d4jxxa1:

• d4jxxa1 is new in SCOPe 2.03-stable
  
• d4jxxa1 appears in SCOPe 2.04
  
• d4jxxa1 appears in the current release, SCOPe 2.08