Lineage for d4jxxa1 (4jxx A:7-338)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2105373Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2105374Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2105375Family c.26.1.1: Class I aminoacyl-tRNA synthetases (RS), catalytic domain [52375] (13 protein domains)
    contains a conserved all-alpha subdomain at the C-terminal extension
  6. 2105394Protein Glutaminyl-tRNA synthetase (GlnRS) [52380] (2 species)
  7. 2105397Species Escherichia coli [TaxId:562] [52381] (17 PDB entries)
  8. 2105406Domain d4jxxa1: 4jxx A:7-338 [224065]
    Other proteins in same PDB: d4jxxa2
    automated match to d1gtra2
    protein/RNA complex; complexed with atp, so4

Details for d4jxxa1

PDB Entry: 4jxx (more details), 2.3 Å

PDB Description: Crystal structure of E coli E. coli glutaminyl-tRNA synthetase bound to tRNA(Gln)(CUG) and ATP from novel cryostabilization conditions
PDB Compounds: (A:) Glutamine--tRNA ligase

SCOPe Domain Sequences for d4jxxa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4jxxa1 c.26.1.1 (A:7-338) Glutaminyl-tRNA synthetase (GlnRS) {Escherichia coli [TaxId: 562]}
ptnfirqiidedlasgkhttvhtrfppepngylhighaksiclnfgiaqdykgqcnlrfd
dtnpvkedieyvesikndvewlgfhwsgnvryssdyfdqlhayaielinkglayvdeltp
eqireyrgtltqpgknspyrdrsveenlalfekmraggfeegkaclrakidmaspfivmr
dpvlyrikfaehhqtgnkwciypmydfthcisdalegithslctlefqdnrrlydwvldn
itipvhprqyefsrlnleytvmskrklnllvtdkhvegwddprmptisglrrrgytaasi
refckrigvtkqdntiemaslesciredlnen

SCOPe Domain Coordinates for d4jxxa1:

Click to download the PDB-style file with coordinates for d4jxxa1.
(The format of our PDB-style files is described here.)

Timeline for d4jxxa1: