Lineage for d4jxrb_ (4jxr B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2968378Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2968379Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (12 families) (S)
  5. 2968970Family d.108.1.0: automated matches [191308] (1 protein)
    not a true family
  6. 2968971Protein automated matches [190038] (49 species)
    not a true protein
  7. 2969423Species Sinorhizobium meliloti [TaxId:266834] [226660] (2 PDB entries)
  8. 2969425Domain d4jxrb_: 4jxr B: [224064]
    automated match to d3dr6a_
    complexed with 2pe, aco, flc, peg

Details for d4jxrb_

PDB Entry: 4jxr (more details), 1.15 Å

PDB Description: crystal structure of a gnat superfamily phosphinothricin acetyltransferase (pat) from sinorhizobium meliloti in complex with accoa
PDB Compounds: (B:) Acetyltransferase

SCOPe Domain Sequences for d4jxrb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4jxrb_ d.108.1.0 (B:) automated matches {Sinorhizobium meliloti [TaxId: 266834]}
mtatlrdavaadlrsiteiyresvlngvatyeetppseaemalrfstitgngypyvvald
ergavigyayasafrnrtayrflvedsiylspeargkgigkallselvgrctalgfrqmi
aviggahpssialhralgfelqglmkatgfkhgrwldtafmqrplgegtatkptegvypd
tlyrs

SCOPe Domain Coordinates for d4jxrb_:

Click to download the PDB-style file with coordinates for d4jxrb_.
(The format of our PDB-style files is described here.)

Timeline for d4jxrb_: