SCOPe 2.08: Domain d4jxrb_: 4jxr B:

Lineage for d4jxrb_ (4jxr B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
   3 layers: a/b/a; contains mixed beta-sheet

4. Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (12 families)

5. Family d.108.1.0: automated matches [191308] (1 protein)
   not a true family

6. Protein automated matches [190038] (49 species)
   not a true protein

7. Species Sinorhizobium meliloti [TaxId:266834] [226660] (2 PDB entries)

8. Domain d4jxrb_: 4jxr B: [224064]
   automated match to d3dr6a_
   complexed with 2pe, aco, flc, peg

Details for d4jxrb_

PDB Entry: 4jxr, 1.15 Å

PDB Description: crystal structure of a gnat superfamily phosphinothricin acetyltransferase (pat) from sinorhizobium meliloti in complex with accoa

PDB Compounds: (B:) Acetyltransferase

SCOPe Domain Sequences for d4jxrb_:

Sequence; same for both SEQRES and ATOM records:

>d4jxrb_ d.108.1.0 (B:) automated matches {Sinorhizobium meliloti [TaxId: 266834]}
mtatlrdavaadlrsiteiyresvlngvatyeetppseaemalrfstitgngypyvvald
ergavigyayasafrnrtayrflvedsiylspeargkgigkallselvgrctalgfrqmi
aviggahpssialhralgfelqglmkatgfkhgrwldtafmqrplgegtatkptegvypd
tlyrs

Timeline for d4jxrb_:

• d4jxrb_ first appeared in SCOPe 2.03
  
• d4jxrb_ appears in SCOPe 2.07