Lineage for d1qba_2 (1qba 28-200)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 223643Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (8 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 223657Superfamily b.2.2: Carbohydrate-binding domain [49384] (3 families) (S)
  5. 223695Family b.2.2.3: Bacterial chitobiase, n-terminal domain [49398] (1 protein)
  6. 223696Protein Bacterial chitobiase, n-terminal domain [49399] (1 species)
  7. 223697Species Serratia marcescens [TaxId:615] [49400] (4 PDB entries)
  8. 223698Domain d1qba_2: 1qba 28-200 [22406]
    Other proteins in same PDB: d1qba_1, d1qba_3, d1qba_4
    complexed with so4

Details for d1qba_2

PDB Entry: 1qba (more details), 1.85 Å

PDB Description: bacterial chitobiase, glycosyl hydrolase family 20

SCOP Domain Sequences for d1qba_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qba_2 b.2.2.3 (28-200) Bacterial chitobiase, n-terminal domain {Serratia marcescens}
dqqlvdqlsqlklnvkmldnragengvdcaalgadwascnrvlftlsndgqaidgkdwvi
yfhsprqtlrvdndqfkiahltgdlykleptakfsgfpagkaveipvvaeywqlfrndfl
prwyatsgdakpkmlantdtenldqfvapftgdqwkrtkddknilmtpasrfv

SCOP Domain Coordinates for d1qba_2:

Click to download the PDB-style file with coordinates for d1qba_2.
(The format of our PDB-style files is described here.)

Timeline for d1qba_2: