| Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
| Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) ![]() |
| Family d.15.4.1: 2Fe-2S ferredoxin-related [54293] (4 proteins) |
| Protein 2Fe-2S ferredoxin [54294] (19 species) |
| Species Pseudomonas putida, putidaredoxin [TaxId:303] [54307] (18 PDB entries) |
| Domain d4jx1g_: 4jx1 G: [224057] Other proteins in same PDB: d4jx1a_, d4jx1b_, d4jx1e_, d4jx1f_ automated match to d4jwud_ complexed with 1n0, ca, cah, cam, fes, hem |
PDB Entry: 4jx1 (more details), 2.09 Å
SCOPe Domain Sequences for d4jx1g_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4jx1g_ d.15.4.1 (G:) 2Fe-2S ferredoxin {Pseudomonas putida, putidaredoxin [TaxId: 303]}
skvvyvshdgtrreldvacgvslmqaavsngiydivgdcggsascatchvyvneaftdkv
paanereigmlesvtaelkpnsrlccqiimtpeldgivvdvpdrqw
Timeline for d4jx1g_: