Lineage for d4jx1e_ (4jx1 E:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004931Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2004932Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2004933Family a.104.1.1: Cytochrome P450 [48265] (23 protein domains)
  6. 2005161Protein Cytochrome P450-CAM [48266] (1 species)
  7. 2005162Species Pseudomonas putida [TaxId:303] [48267] (115 PDB entries)
    Uniprot P00183
  8. 2005219Domain d4jx1e_: 4jx1 E: [224055]
    Other proteins in same PDB: d4jx1c_, d4jx1d_, d4jx1g_, d4jx1h_
    automated match to d4jwua_
    complexed with 1n0, ca, cah, cam, fes, hem

Details for d4jx1e_

PDB Entry: 4jx1 (more details), 2.09 Å

PDB Description: crystal structure of reduced cytochrome p450cam-putidaredoxin complex bound to camphor and 5-exo-hydroxycamphor
PDB Compounds: (E:) Camphor 5-monooxygenase

SCOPe Domain Sequences for d4jx1e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4jx1e_ a.104.1.1 (E:) Cytochrome P450-CAM {Pseudomonas putida [TaxId: 303]}
nlaplpphvpehlvfdfdmynpsnlsagvqeawavlqesnvpdlvwtrsngghwiatrgq
lireayedyrhfssespfipreageaydfiptsmdppeqrqfralanqvvgmpvvdklen
riqelasslieslrpqgqcnftedyaepfpirifmllaglpeediphlkyltdqmtrpdg
smtfaeakealydylipiieqrrqkpgtdaisivangqvngrpitsdeakrmcglllvgg
ldtvvnflsfsmeflakspehrqelierperipaaseellrrfslvadgriltsdyefhg
vqlkkgdqillpqmlsglderenaapmhvdfsrqcvshttfghgshlclgqhlarreiiv
tlkewltripdfsiapgaqiqhksgivsgvqalplvwdpattkav

SCOPe Domain Coordinates for d4jx1e_:

Click to download the PDB-style file with coordinates for d4jx1e_.
(The format of our PDB-style files is described here.)

Timeline for d4jx1e_: