![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.104: Cytochrome P450 [48263] (1 superfamily) multihelical |
![]() | Superfamily a.104.1: Cytochrome P450 [48264] (2 families) ![]() |
![]() | Family a.104.1.1: Cytochrome P450 [48265] (23 proteins) |
![]() | Protein Cytochrome P450-CAM [48266] (1 species) |
![]() | Species Pseudomonas putida [TaxId:303] [48267] (118 PDB entries) Uniprot P00183 |
![]() | Domain d4jx1a_: 4jx1 A: [224051] Other proteins in same PDB: d4jx1c_, d4jx1d_, d4jx1g_, d4jx1h_ automated match to d4jwua_ complexed with 1n0, ca, cah, cam, fes, hem |
PDB Entry: 4jx1 (more details), 2.09 Å
SCOPe Domain Sequences for d4jx1a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4jx1a_ a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas putida [TaxId: 303]} nlaplpphvpehlvfdfdmynpsnlsagvqeawavlqesnvpdlvwtrsngghwiatrgq lireayedyrhfssespfipreageaydfiptsmdppeqrqfralanqvvgmpvvdklen riqelasslieslrpqgqcnftedyaepfpirifmllaglpeediphlkyltdqmtrpdg smtfaeakealydylipiieqrrqkpgtdaisivangqvngrpitsdeakrmcglllvgg ldtvvnflsfsmeflakspehrqelierperipaaseellrrfslvadgriltsdyefhg vqlkkgdqillpqmlsglderenaapmhvdfsrqcvshttfghgshlclgqhlarreiiv tlkewltripdfsiapgaqiqhksgivsgvqalplvwdpattkav
Timeline for d4jx1a_: