Lineage for d1g1kb_ (1g1k B:)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 368237Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (8 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 368251Superfamily b.2.2: Carbohydrate-binding domain [49384] (3 families) (S)
  5. 368265Family b.2.2.2: Cellulose-binding domain family III [49390] (3 proteins)
  6. 368272Protein Cohesin domain [49396] (1 species)
  7. 368273Species Clostridium thermocellum, cellulosome, various modules [TaxId:1515] [49397] (4 PDB entries)
  8. 368278Domain d1g1kb_: 1g1k B: [22405]
    cohesin domain of cellulosome

Details for d1g1kb_

PDB Entry: 1g1k (more details), 2 Å

PDB Description: cohesin module from the cellulosome of clostridium cellulolyticum

SCOP Domain Sequences for d1g1kb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g1kb_ b.2.2.2 (B:) Cohesin domain {Clostridium thermocellum, cellulosome, various modules}
aslkvtvgtangkpgdtvtvpvtfadvakmknvgtcnfylgydasllevvsvdagpivkn
aavnfsssasngtisflfldntitdelitadgvfanikfklksvtaktttpvtfkdggaf
gdgtmskiasvtktngsvtidpg

SCOP Domain Coordinates for d1g1kb_:

Click to download the PDB-style file with coordinates for d1g1kb_.
(The format of our PDB-style files is described here.)

Timeline for d1g1kb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1g1ka_