Lineage for d4jwva1 (4jwv A:3-257)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2099098Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2099099Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2100042Family c.14.1.0: automated matches [191346] (1 protein)
    not a true family
  6. 2100043Protein automated matches [190246] (54 species)
    not a true protein
  7. 2100462Species Novosphingobium aromaticivorans [TaxId:279238] [226680] (3 PDB entries)
  8. 2100463Domain d4jwva1: 4jwv A:3-257 [224049]
    Other proteins in same PDB: d4jwva2
    automated match to d3tlfd_

Details for d4jwva1

PDB Entry: 4jwv (more details), 2.1 Å

PDB Description: crystal structure of putative short chain enoyl-coa hydratase from novosphingobium aromaticivorans dsm 12444
PDB Compounds: (A:) Short chain enoyl-CoA hydratase

SCOPe Domain Sequences for d4jwva1:

Sequence, based on SEQRES records: (download)

>d4jwva1 c.14.1.0 (A:3-257) automated matches {Novosphingobium aromaticivorans [TaxId: 279238]}
adidfrieghvahvrlnrpqglnaitqemddllldawtevnansdiwavvlsaegekafc
igadvsggaerktrmalgggltgiggplvtckkpmvaavqgfcvgggfelamcadiivaa
dtaqfglpetkvgiigecgvvhramrqlpyhialqliltgerikadearhyglvnevvpf
aeleeaalrwasklnaasplavqaakaaalgrlghplevalmtrfepieeyaatedkkeg
eraagerrkpvwtgk

Sequence, based on observed residues (ATOM records): (download)

>d4jwva1 c.14.1.0 (A:3-257) automated matches {Novosphingobium aromaticivorans [TaxId: 279238]}
adidfrieghvahvrlnrpqglnaitqemddllldawtevnansdiwavvlsaegekafc
igadvrktrmalgggltgiggplvtckkpmvaavqgfcvgggfelamcadiivaadtaqf
glpetkvgiigecgvvhramrqlpyhialqliltgerikadearhyglvnevvpfaelee
aalrwasklnaasplavqaakaaalgrlghplevalmtrfepieeyaatedkkegeraag
errkpvwtgk

SCOPe Domain Coordinates for d4jwva1:

Click to download the PDB-style file with coordinates for d4jwva1.
(The format of our PDB-style files is described here.)

Timeline for d4jwva1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4jwva2
View in 3D
Domains from other chains:
(mouse over for more information)
d4jwvb_