Lineage for d4jv9a_ (4jv9 A:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1270168Fold a.42: SWIB/MDM2 domain [47591] (1 superfamily)
    core: 4 helices: open bundle; capped by two small 3-stranded beta-sheets
    duplication: consists of two structural repeats
  4. 1270169Superfamily a.42.1: SWIB/MDM2 domain [47592] (2 families) (S)
    binds to the transactivation domain of human p53
  5. 1270170Family a.42.1.1: SWIB/MDM2 domain [47593] (4 proteins)
    Pfam PF02201
  6. 1270177Protein MDM2 [47594] (2 species)
  7. 1270190Species Human (Homo sapiens) [TaxId:9606] [47596] (36 PDB entries)
  8. 1270252Domain d4jv9a_: 4jv9 A: [224044]
    automated match to d4jvra_
    complexed with 1mo, so4

Details for d4jv9a_

PDB Entry: 4jv9 (more details), 2.5 Å

PDB Description: Co-crystal structure of MDM2 with inhibitor (2S,5R,6S)-2-benzyl-5,6-bis(4-chlorophenyl)-4-methylmorpholin-3-one
PDB Compounds: (A:) E3 ubiquitin-protein ligase Mdm2

SCOPe Domain Sequences for d4jv9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4jv9a_ a.42.1.1 (A:) MDM2 {Human (Homo sapiens) [TaxId: 9606]}
tlvrpkplllkllksvgaqkdtytmkevlfylgqyimtkrlydekqqhivycsndllgdl
fgvpsfsvkehrkiytmiyrnlvvv

SCOPe Domain Coordinates for d4jv9a_:

Click to download the PDB-style file with coordinates for d4jv9a_.
(The format of our PDB-style files is described here.)

Timeline for d4jv9a_: