Lineage for d4juub_ (4juu B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2939535Fold d.21: Diaminopimelate epimerase-like [54505] (1 superfamily)
    mixed beta-sheet folds into a barrel (n=8, S=14) around the central helix
  4. 2939536Superfamily d.21.1: Diaminopimelate epimerase-like [54506] (5 families) (S)
    duplication: consists of two similar domain swapped with C-terminal strands
  5. 2939665Family d.21.1.0: automated matches [191386] (1 protein)
    not a true family
  6. 2939666Protein automated matches [190491] (18 species)
    not a true protein
  7. 2939769Species Xanthomonas campestris [TaxId:190485] [226641] (1 PDB entry)
  8. 2939771Domain d4juub_: 4juu B: [224041]
    Other proteins in same PDB: d4juua2
    automated match to d1tm0a_
    complexed with cl, po4, unl

Details for d4juub_

PDB Entry: 4juu (more details), 1.75 Å

PDB Description: crystal structure of a putative hydroxyproline epimerase from xanthomonas campestris (target efi-506516) with bound phosphate and unknown ligand
PDB Compounds: (B:) Epimerase

SCOPe Domain Sequences for d4juub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4juub_ d.21.1.0 (B:) automated matches {Xanthomonas campestris [TaxId: 190485]}
htidvidshtageptrvvlagfpdlgdgdlaqcrerfrsdfdhwrsaiaceprgsdtmvg
alllpprdpsactgviffnnvgylgmcghgtigvvrtlaelgriapgqhrietpvgtvgv
aladdgtvsidnvesyrhaagvevdvpghgrvrgdvawggnwffiteqapcalglaqqre
ltayteairlaleaagitgeaggeidhieisgvapdgsgaarnfvlcpglaydrspcgtg
tsaklaclaadgklaegerwlqqgilgsafegsyrhsgrgiaprisghafitarsqllid
padpfawgiva

SCOPe Domain Coordinates for d4juub_:

Click to download the PDB-style file with coordinates for d4juub_.
(The format of our PDB-style files is described here.)

Timeline for d4juub_: