Lineage for d4juua1 (4juu A:1-312)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2184294Fold d.21: Diaminopimelate epimerase-like [54505] (1 superfamily)
    mixed beta-sheet folds into a barrel (n=8, S=14) around the central helix
  4. 2184295Superfamily d.21.1: Diaminopimelate epimerase-like [54506] (5 families) (S)
    duplication: consists of two similar domain swapped with C-terminal strands
  5. 2184409Family d.21.1.0: automated matches [191386] (1 protein)
    not a true family
  6. 2184410Protein automated matches [190491] (15 species)
    not a true protein
  7. 2184477Species Xanthomonas campestris [TaxId:190485] [226641] (1 PDB entry)
  8. 2184478Domain d4juua1: 4juu A:1-312 [224040]
    Other proteins in same PDB: d4juua2
    automated match to d1tm0a_
    complexed with cl, po4, unl

Details for d4juua1

PDB Entry: 4juu (more details), 1.75 Å

PDB Description: crystal structure of a putative hydroxyproline epimerase from xanthomonas campestris (target efi-506516) with bound phosphate and unknown ligand
PDB Compounds: (A:) Epimerase

SCOPe Domain Sequences for d4juua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4juua1 d.21.1.0 (A:1-312) automated matches {Xanthomonas campestris [TaxId: 190485]}
mhtidvidshtageptrvvlagfpdlgdgdlaqcrerfrsdfdhwrsaiaceprgsdtmv
galllpprdpsactgviffnnvgylgmcghgtigvvrtlaelgriapgqhrietpvgtvg
valaddgtvsidnvesyrhaagvevdvpghgrvrgdvawggnwffiteqapcalglaqqr
eltayteairlaleaagitgeaggeidhieisgvapdgsgaarnfvlcpglaydrspcgt
gtsaklaclaadgklaegerwlqqgilgsafegsyrhsgrgiaprisghafitarsqlli
dpadpfawgiva

SCOPe Domain Coordinates for d4juua1:

Click to download the PDB-style file with coordinates for d4juua1.
(The format of our PDB-style files is described here.)

Timeline for d4juua1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4juua2
View in 3D
Domains from other chains:
(mouse over for more information)
d4juub_