Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.21: Diaminopimelate epimerase-like [54505] (1 superfamily) mixed beta-sheet folds into a barrel (n=8, S=14) around the central helix |
Superfamily d.21.1: Diaminopimelate epimerase-like [54506] (5 families) duplication: consists of two similar domain swapped with C-terminal strands |
Family d.21.1.0: automated matches [191386] (1 protein) not a true family |
Protein automated matches [190491] (15 species) not a true protein |
Species Xanthomonas campestris [TaxId:190485] [226641] (1 PDB entry) |
Domain d4juua1: 4juu A:1-312 [224040] Other proteins in same PDB: d4juua2 automated match to d1tm0a_ complexed with cl, po4, unl |
PDB Entry: 4juu (more details), 1.75 Å
SCOPe Domain Sequences for d4juua1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4juua1 d.21.1.0 (A:1-312) automated matches {Xanthomonas campestris [TaxId: 190485]} mhtidvidshtageptrvvlagfpdlgdgdlaqcrerfrsdfdhwrsaiaceprgsdtmv galllpprdpsactgviffnnvgylgmcghgtigvvrtlaelgriapgqhrietpvgtvg valaddgtvsidnvesyrhaagvevdvpghgrvrgdvawggnwffiteqapcalglaqqr eltayteairlaleaagitgeaggeidhieisgvapdgsgaarnfvlcpglaydrspcgt gtsaklaclaadgklaegerwlqqgilgsafegsyrhsgrgiaprisghafitarsqlli dpadpfawgiva
Timeline for d4juua1: