SCOPe 2.02: Domain d1g1ka_: 1g1k A:

Lineage for d1g1ka_ (1g1k A:)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.2: Carbohydrate-binding domain [49384] (4 families)

5. Family b.2.2.2: Cellulose-binding domain family III [49390] (9 proteins)
   Pfam PF00963

6. Protein Cohesin domain [49396] (2 species)

7. Species Clostridium thermocellum, cellulosome, various modules [TaxId:1515] [49397] (4 PDB entries)

8. Domain d1g1ka_: 1g1k A: [22404]
   cohesin domain of cellulosome

Details for d1g1ka_

PDB Entry: 1g1k, 2 Å

PDB Description: cohesin module from the cellulosome of clostridium cellulolyticum

PDB Compounds: (A:) scaffolding protein

SCOPe Domain Sequences for d1g1ka_:

Sequence; same for both SEQRES and ATOM records:

>d1g1ka_ b.2.2.2 (A:) Cohesin domain {Clostridium thermocellum, cellulosome, various modules [TaxId: 1515]}
aslkvtvgtangkpgdtvtvpvtfadvakmknvgtcnfylgydasllevvsvdagpivkn
aavnfsssasngtisflfldntitdelitadgvfanikfklksvtaktttpvtfkdggaf
gdgtmskiasvtktngsvtidpg

Timeline for d1g1ka_:

• d1g1ka_ first appeared (with stable ids) in SCOP 1.55
  
• d1g1ka_ appears in SCOPe 2.01
  
• d1g1ka_ appears in SCOPe 2.03
  
• d1g1ka_ appears in the current release, SCOPe 2.08, called d1g1ka1