Lineage for d4juhe1 (4juh E:5-325)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2775473Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2775474Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2775521Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)
  6. 2775522Protein Hemagglutinin [49824] (22 species)
    includes rudiment esterase domain
  7. 2775631Species Influenza A virus, different strains [TaxId:11320] [49825] (131 PDB entries)
  8. 2775843Domain d4juhe1: 4juh E:5-325 [224039]
    Other proteins in same PDB: d4juha2, d4juhb_, d4juhc2, d4juhd_, d4juhe2, d4juhf_
    automated match to d4juga_
    mutant

Details for d4juhe1

PDB Entry: 4juh (more details), 2.81 Å

PDB Description: crystal structure of 1918 pandemic influenza virus hemagglutinin mutant d225g complexed with avian receptor analogue lsta
PDB Compounds: (E:) Hemagglutinin

SCOPe Domain Sequences for d4juhe1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4juhe1 b.19.1.2 (E:5-325) Hemagglutinin {Influenza A virus, different strains [TaxId: 11320]}
dticigyhannstdtvdtvleknvtvthsvnlledshngklcklkgiaplqlgkcniagw
llgnpecdllltasswsyivetsnsengtcypgdfidyeelreqlssvssfekfeifpkt
sswpnhettkgvtaacsyagassfyrnllwltkkgssypklsksyvnnkgkevlvlwgvh
hpptgtdqqslyqnadayvsvgsskynrrftpeiaarpkvrgqagrmnyywtllepgdti
tfeatgnliapwyafalnrgsgsgiitsdapvhdcntkcqtphgainsslpfqnihpvti
gecpkyvrstklrmatglrnip

SCOPe Domain Coordinates for d4juhe1:

Click to download the PDB-style file with coordinates for d4juhe1.
(The format of our PDB-style files is described here.)

Timeline for d4juhe1: