SCOPe 2.08: Domain d4juha1: 4juh A:5-325

Lineage for d4juha1 (4juh A:5-325)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.19: Viral protein domain [49817] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll; form trimers

4. Superfamily b.19.1: Viral protein domain [49818] (4 families)
   forms homotrimers

5. Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)

6. Protein Hemagglutinin [49824] (22 species)
   includes rudiment esterase domain

7. Species Influenza A virus, different strains [TaxId:11320] [49825] (131 PDB entries)

8. Domain d4juha1: 4juh A:5-325 [224037]
   Other proteins in same PDB: d4juha2, d4juhb_, d4juhc2, d4juhd_, d4juhe2, d4juhf_
   automated match to d4juga_
   mutant

Details for d4juha1

PDB Entry: 4juh, 2.81 Å

PDB Description: crystal structure of 1918 pandemic influenza virus hemagglutinin mutant d225g complexed with avian receptor analogue lsta

PDB Compounds: (A:) Hemagglutinin

SCOPe Domain Sequences for d4juha1:

Sequence; same for both SEQRES and ATOM records:

>d4juha1 b.19.1.2 (A:5-325) Hemagglutinin {Influenza A virus, different strains [TaxId: 11320]}
dticigyhannstdtvdtvleknvtvthsvnlledshngklcklkgiaplqlgkcniagw
llgnpecdllltasswsyivetsnsengtcypgdfidyeelreqlssvssfekfeifpkt
sswpnhettkgvtaacsyagassfyrnllwltkkgssypklsksyvnnkgkevlvlwgvh
hpptgtdqqslyqnadayvsvgsskynrrftpeiaarpkvrgqagrmnyywtllepgdti
tfeatgnliapwyafalnrgsgsgiitsdapvhdcntkcqtphgainsslpfqnihpvti
gecpkyvrstklrmatglrnip

Timeline for d4juha1:

• d4juha1 first appeared in SCOPe 2.03, called d4juha_
  
• d4juha1 appears in SCOPe 2.07