| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.20: UBC-like [54494] (1 superfamily) alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2 |
Superfamily d.20.1: UBC-like [54495] (5 families) ![]() |
| Family d.20.1.1: UBC-related [54496] (7 proteins) |
| Protein automated matches [190124] (13 species) not a true protein |
| Species Plasmodium falciparum [TaxId:36329] [187963] (5 PDB entries) |
| Domain d4jued_: 4jue D: [224036] automated match to d3rczb_ |
PDB Entry: 4jue (more details), 1.85 Å
SCOPe Domain Sequences for d4jued_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4jued_ d.20.1.1 (D:) automated matches {Plasmodium falciparum [TaxId: 36329]}
msiakkrlaqeraewrkdhpagfsakyspmsdgkgldimkwickipgkkgglweggeypl
tmeftedypskppkckfttvlfhpniypsgtvclsilnededwkpsitikqillgiqdll
dnpnpnspaqaepfllyqqdrdsyekkvkkqaiefrpkd
Timeline for d4jued_: