![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.20: UBC-like [54494] (1 superfamily) alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2 |
![]() | Superfamily d.20.1: UBC-like [54495] (5 families) ![]() |
![]() | Family d.20.1.1: UBC-related [54496] (7 proteins) |
![]() | Protein automated matches [190124] (13 species) not a true protein |
![]() | Species Plasmodium falciparum [TaxId:36329] [187963] (5 PDB entries) |
![]() | Domain d4juec_: 4jue C: [224035] automated match to d3rczb_ |
PDB Entry: 4jue (more details), 1.85 Å
SCOPe Domain Sequences for d4juec_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4juec_ d.20.1.1 (C:) automated matches {Plasmodium falciparum [TaxId: 36329]} msiakkrlaqeraewrkdhpagfsakyspmsdgkgldimkwickipgkkgglweggeypl tmeftedypskppkckfttvlfhpniypsgtvclsilnededwkpsitikqillgiqdll dnpnpnspaqaepfllyqqdrdsyekkvkkqaiefrpkd
Timeline for d4juec_: