SCOPe 2.03: Domain d4jueb_: 4jue B:

Lineage for d4jueb_ (4jue B:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.20: UBC-like [54494] (1 superfamily)
   alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2

4. Superfamily d.20.1: UBC-like [54495] (5 families)

5. Family d.20.1.1: UBC-related [54496] (7 proteins)

6. Protein automated matches [190124] (12 species)
   not a true protein

7. Species Plasmodium falciparum [TaxId:36329] [187963] (5 PDB entries)

8. Domain d4jueb_: 4jue B: [224034]
   automated match to d3rczb_

Details for d4jueb_

PDB Entry: 4jue, 1.85 Å

PDB Description: crystal structure of plasmodium falciparum ubiquitin conjugating enzyme ubc9

PDB Compounds: (B:) Ubiquitin conjugating enzyme UBC9

SCOPe Domain Sequences for d4jueb_:

Sequence; same for both SEQRES and ATOM records:

>d4jueb_ d.20.1.1 (B:) automated matches {Plasmodium falciparum [TaxId: 36329]}
msiakkrlaqeraewrkdhpagfsakyspmsdgkgldimkwickipgkkgglweggeypl
tmeftedypskppkckfttvlfhpniypsgtvclsilnededwkpsitikqillgiqdll
dnpnpnspaqaepfllyqqdrdsyekkvkkqaiefrpkd

Timeline for d4jueb_:

• d4jueb_ is new in SCOPe 2.03-stable
  
• d4jueb_ appears in SCOPe 2.04
  
• d4jueb_ appears in the current release, SCOPe 2.08