SCOPe 2.02: Domain d1anua_: 1anu A:

Lineage for d1anua_ (1anu A:)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.2: Carbohydrate-binding domain [49384] (4 families)

5. Family b.2.2.2: Cellulose-binding domain family III [49390] (9 proteins)
   Pfam PF00963

6. Protein Cohesin domain [49396] (2 species)

7. Species Clostridium thermocellum, cellulosome, various modules [TaxId:1515] [49397] (4 PDB entries)

8. Domain d1anua_: 1anu A: [22403]
   cohesin-2 domain of cellulosome

Details for d1anua_

PDB Entry: 1anu, 2.15 Å

PDB Description: cohesin-2 domain of the cellulosome from clostridium thermocellum

PDB Compounds: (A:) cohesin-2

SCOPe Domain Sequences for d1anua_:

Sequence; same for both SEQRES and ATOM records:

>d1anua_ b.2.2.2 (A:) Cohesin domain {Clostridium thermocellum, cellulosome, various modules [TaxId: 1515]}
vvveigkvtgsvgttveipvyfrgvpskgiancdfvfrydpnvleiigidpgdiivdpnp
tksfdtaiypdrkiivflfaedsgtgayaitkdgvfakiratvkssapgyitfdevggfa
dndlveqkvsfidggvnv

Timeline for d1anua_:

• d1anua_ first appeared (with stable ids) in SCOP 1.55, called d1anu__
  
• d1anua_ appears in SCOPe 2.01
  
• d1anua_ appears in SCOPe 2.03
  
• d1anua_ appears in the current release, SCOPe 2.08