SCOP 1.67: Domain d1anu__: 1anu -

Lineage for d1anu__ (1anu -)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (8 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.2: Carbohydrate-binding domain [49384] (3 families)

5. Family b.2.2.2: Cellulose-binding domain family III [49390] (3 proteins)

6. Protein Cohesin domain [49396] (1 species)

7. Species Clostridium thermocellum, cellulosome, various modules [TaxId:1515] [49397] (4 PDB entries)

8. Domain d1anu__: 1anu - [22403]
   cohesin-2 domain of cellulosome

Details for d1anu__

PDB Entry: 1anu, 2.15 Å

PDB Description: cohesin-2 domain of the cellulosome from clostridium thermocellum

SCOP Domain Sequences for d1anu__:

Sequence; same for both SEQRES and ATOM records:

>d1anu__ b.2.2.2 (-) Cohesin domain {Clostridium thermocellum, cellulosome, various modules}
vvveigkvtgsvgttveipvyfrgvpskgiancdfvfrydpnvleiigidpgdiivdpnp
tksfdtaiypdrkiivflfaedsgtgayaitkdgvfakiratvkssapgyitfdevggfa
dndlveqkvsfidggvnv

Timeline for d1anu__:

• d1anu__ first appeared (with stable ids) in SCOP 1.55
  
• d1anu__ appears in SCOP 1.65
  
• d1anu__ appears in SCOP 1.69
  
• d1anu__ appears in the current release, SCOPe 2.08, called d1anua_