Lineage for d1anu__ (1anu -)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 10320Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (7 superfamilies)
  4. 10334Superfamily b.2.2: Carbohydrate-binding domain [49384] (3 families) (S)
  5. 10344Family b.2.2.2: Cellulose-binding domain family III [49390] (3 proteins)
  6. 10351Protein Cohesin domain [49396] (1 species)
  7. 10352Species Clostridium thermocellum, cellulosome, various modules [TaxId:1515] [49397] (3 PDB entries)
  8. 10355Domain d1anu__: 1anu - [22403]

Details for d1anu__

PDB Entry: 1anu (more details), 2.15 Å

PDB Description: cohesin-2 domain of the cellulosome from clostridium thermocellum

SCOP Domain Sequences for d1anu__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1anu__ b.2.2.2 (-) Cohesin domain {Clostridium thermocellum, cellulosome, various modules}
vvveigkvtgsvgttveipvyfrgvpskgiancdfvfrydpnvleiigidpgdiivdpnp
tksfdtaiypdrkiivflfaedsgtgayaitkdgvfakiratvkssapgyitfdevggfa
dndlveqkvsfidggvnv

SCOP Domain Coordinates for d1anu__:

Click to download the PDB-style file with coordinates for d1anu__.
(The format of our PDB-style files is described here.)

Timeline for d1anu__: