Lineage for d1aohb_ (1aoh B:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1300526Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 1300542Superfamily b.2.2: Carbohydrate-binding domain [49384] (4 families) (S)
  5. 1300556Family b.2.2.2: Cellulose-binding domain family III [49390] (9 proteins)
    Pfam PF00963
  6. 1300577Protein Cohesin domain [49396] (2 species)
  7. 1300582Species Clostridium thermocellum, cellulosome, various modules [TaxId:1515] [49397] (4 PDB entries)
  8. 1300584Domain d1aohb_: 1aoh B: [22402]
    cohesin domain from scaffolding protein CipA

Details for d1aohb_

PDB Entry: 1aoh (more details), 1.7 Å

PDB Description: single cohesin domain from the scaffolding protein cipa of the clostridium thermocellum cellulosome
PDB Compounds: (B:) cellulosome-integrating protein cipa

SCOPe Domain Sequences for d1aohb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aohb_ b.2.2.2 (B:) Cohesin domain {Clostridium thermocellum, cellulosome, various modules [TaxId: 1515]}
tdldavrikvdtvnakpgdtvripvrfsgipskgiancdfvysydpnvleiieiepgeli
vdpnptksfdtavypdrkmivflfaedsgtgayaitedgvfativakvksgapnglsvik
fvevggfanndlveqktqffdggvnvg

SCOPe Domain Coordinates for d1aohb_:

Click to download the PDB-style file with coordinates for d1aohb_.
(The format of our PDB-style files is described here.)

Timeline for d1aohb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1aoha_