![]() | Class b: All beta proteins [48724] (141 folds) |
![]() | Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (8 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
![]() | Superfamily b.2.2: Carbohydrate-binding domain [49384] (3 families) ![]() |
![]() | Family b.2.2.2: Cellulose-binding domain family III [49390] (3 proteins) |
![]() | Protein Cohesin domain [49396] (1 species) |
![]() | Species Clostridium thermocellum, cellulosome, various modules [TaxId:1515] [49397] (4 PDB entries) |
![]() | Domain d1aohb_: 1aoh B: [22402] cohesin domain from scaffolding protein CipA |
PDB Entry: 1aoh (more details), 1.7 Å
SCOP Domain Sequences for d1aohb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1aohb_ b.2.2.2 (B:) Cohesin domain {Clostridium thermocellum, cellulosome, various modules} tdldavrikvdtvnakpgdtvripvrfsgipskgiancdfvysydpnvleiieiepgeli vdpnptksfdtavypdrkmivflfaedsgtgayaitedgvfativakvksgapnglsvik fvevggfanndlveqktqffdggvnvg
Timeline for d1aohb_: