SCOP 1.57: Domain d1aohb_: 1aoh B:

Lineage for d1aohb_ (1aoh B:)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (7 superfamilies)

4. Superfamily b.2.2: Carbohydrate-binding domain [49384] (3 families)

5. Family b.2.2.2: Cellulose-binding domain family III [49390] (3 proteins)

6. Protein Cohesin domain [49396] (1 species)

7. Species Clostridium thermocellum, cellulosome, various modules [TaxId:1515] [49397] (3 PDB entries)

8. Domain d1aohb_: 1aoh B: [22402]

Details for d1aohb_

PDB Entry: 1aoh, 1.7 Å

PDB Description: single cohesin domain from the scaffolding protein cipa of the clostridium thermocellum cellulosome

SCOP Domain Sequences for d1aohb_:

Sequence; same for both SEQRES and ATOM records:

>d1aohb_ b.2.2.2 (B:) Cohesin domain {Clostridium thermocellum, cellulosome, various modules}
tdldavrikvdtvnakpgdtvripvrfsgipskgiancdfvysydpnvleiieiepgeli
vdpnptksfdtavypdrkmivflfaedsgtgayaitedgvfativakvksgapnglsvik
fvevggfanndlveqktqffdggvnvg

Timeline for d1aohb_:

• d1aohb_ first appeared (with stable ids) in SCOP 1.55
  
• d1aohb_ appears in SCOP 1.59
  
• d1aohb_ appears in the current release, SCOPe 2.08, called d1aohb1