SCOPe 2.08: Domain d1aohb1: 1aoh B:2-147

Lineage for d1aohb1 (1aoh B:2-147)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.2: Carbohydrate-binding domain [49384] (4 families)

5. Family b.2.2.2: Cellulose-binding domain family III [49390] (9 proteins)
   Pfam PF00963

6. Protein Cohesin domain [49396] (2 species)

7. Species Clostridium thermocellum, cellulosome, various modules [TaxId:1515] [49397] (4 PDB entries)

8. Domain d1aohb1: 1aoh B:2-147 [22402]
   Other proteins in same PDB: d1aohb2
   cohesin domain from scaffolding protein CipA

Details for d1aohb1

PDB Entry: 1aoh, 1.7 Å

PDB Description: single cohesin domain from the scaffolding protein cipa of the clostridium thermocellum cellulosome

PDB Compounds: (B:) Cellulosomal-scaffolding protein A

SCOPe Domain Sequences for d1aohb1:

Sequence; same for both SEQRES and ATOM records:

>d1aohb1 b.2.2.2 (B:2-147) Cohesin domain {Clostridium thermocellum, cellulosome, various modules [TaxId: 1515]}
dldavrikvdtvnakpgdtvripvrfsgipskgiancdfvysydpnvleiieiepgeliv
dpnptksfdtavypdrkmivflfaedsgtgayaitedgvfativakvksgapnglsvikf
vevggfanndlveqktqffdggvnvg

Timeline for d1aohb1:

• d1aohb1 first appeared (with stable ids) in SCOP 1.55, called d1aohb_
  
• d1aohb1 appears in SCOPe 2.07