Lineage for d4jtja_ (4jtj A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2413227Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2420459Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2421459Family c.1.10.4: Class I DAHP synthetase [51599] (3 protein domains)
  6. 2421656Protein automated matches [190083] (9 species)
    not a true protein
  7. 2421681Species Neisseria meningitidis [TaxId:122586] [189819] (16 PDB entries)
  8. 2421702Domain d4jtja_: 4jtj A: [224012]
    automated match to d3undc_
    complexed with cl, na; mutant

Details for d4jtja_

PDB Entry: 4jtj (more details), 1.75 Å

PDB Description: Crystal structure of R117K mutant of 3-deoxy-D-manno-octulosonate 8-phosphate synthase (KDO8PS) from Neisseria meningitidis
PDB Compounds: (A:) 2-dehydro-3-deoxyphosphooctonate aldolase

SCOPe Domain Sequences for d4jtja_:

Sequence, based on SEQRES records: (download)

>d4jtja_ c.1.10.4 (A:) automated matches {Neisseria meningitidis [TaxId: 122586]}
mdikinditlgnnspfvlfgginvlesldstlqtcahyvevtrklgipyifkasfdkanr
ssihsyrgvgleeglkifekvkaefgipvitdvhephqcqpvaevcdviqlpaflakqtd
lvvamaktgnvvnikkpqflspsqmknivekfheagngklilcergssfgydnlvvdmlg
fgvmkqtcgnlpvifdvthslqtrdagsaasggrraqaldlalagmatrlaglfleshpd
pklakcdgpsalplhlledflirikalddliksqpil

Sequence, based on observed residues (ATOM records): (download)

>d4jtja_ c.1.10.4 (A:) automated matches {Neisseria meningitidis [TaxId: 122586]}
mdikinditlgnnspfvlfgginvlesldstlqtcahyvevtrklgipyifkasfdkanr
ssihsyrgvgleeglkifekvkaefgipvitdvhephqcqpvaevcdviqlpaflakqtd
lvvamaktgnvvnikkpqflspsqmknivekfheagngklilcergssfgydnlvvdmlg
fgvmkqtcgnlpvifdvthslqtrgrraqaldlalagmatrlaglfleslhlledfliri
kalddliksqpil

SCOPe Domain Coordinates for d4jtja_:

Click to download the PDB-style file with coordinates for d4jtja_.
(The format of our PDB-style files is described here.)

Timeline for d4jtja_: