| Class b: All beta proteins [48724] (180 folds) |
| Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
Superfamily b.2.2: Carbohydrate-binding domain [49384] (4 families) ![]() |
| Family b.2.2.2: Cellulose-binding domain family III [49390] (9 proteins) Pfam PF00963 |
| Protein Endo/exocellulase:cellobiose E-4, C-terminal domain [49394] (2 species) |
| Species Thermobifida fusca [TaxId:2021] [49395] (4 PDB entries) |
| Domain d3tf4b2: 3tf4 B:461-605 [22400] Other proteins in same PDB: d3tf4a1, d3tf4b1 complexed with bgc, ca |
PDB Entry: 3tf4 (more details), 2.2 Å
SCOPe Domain Sequences for d3tf4b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3tf4b2 b.2.2.2 (B:461-605) Endo/exocellulase:cellobiose E-4, C-terminal domain {Thermobifida fusca [TaxId: 2021]}
peifveaqintpgttfteikamirnqsgwparmldkgtfrywftldegvdpaditvssay
nqcatpedvhhvsgdlyyveidctgekifpggqsehrrevqfriaggpgwdpsndwsfqg
ignelapapyivlyddgvpvwgtap
Timeline for d3tf4b2: