SCOP 1.73: Domain d3tf4a2: 3tf4 A:461-605

Lineage for d3tf4a2 (3tf4 A:461-605)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.2: Carbohydrate-binding domain [49384] (3 families)

5. Family b.2.2.2: Cellulose-binding domain family III [49390] (6 proteins)
   Pfam PF00963

6. Protein Endo/exocellulase:cellobiose E-4, C-terminal domain [49394] (2 species)

7. Species Thermomonospora fusca [TaxId:2021] [49395] (4 PDB entries)

8. Domain d3tf4a2: 3tf4 A:461-605 [22399]
   Other proteins in same PDB: d3tf4a1, d3tf4b1

Details for d3tf4a2

PDB Entry: 3tf4, 2.2 Å

PDB Description: endo/exocellulase:cellotriose from thermomonospora

PDB Compounds: (A:) t. fusca endo/exo-cellulase e4 catalytic domain and cellulose-binding domain

SCOP Domain Sequences for d3tf4a2:

Sequence; same for both SEQRES and ATOM records:

>d3tf4a2 b.2.2.2 (A:461-605) Endo/exocellulase:cellobiose E-4, C-terminal domain {Thermomonospora fusca [TaxId: 2021]}
peifveaqintpgttfteikamirnqsgwparmldkgtfrywftldegvdpaditvssay
nqcatpedvhhvsgdlyyveidctgekifpggqsehrrevqfriaggpgwdpsndwsfqg
ignelapapyivlyddgvpvwgtap

Timeline for d3tf4a2:

• d3tf4a2 first appeared (with stable ids) in SCOP 1.55
  
• d3tf4a2 appears in SCOP 1.71
  
• d3tf4a2 appears in SCOP 1.75
  
• d3tf4a2 appears in the current release, SCOPe 2.08