![]() | Class b: All beta proteins [48724] (126 folds) |
![]() | Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (8 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
![]() | Superfamily b.2.2: Carbohydrate-binding domain [49384] (3 families) ![]() |
![]() | Family b.2.2.2: Cellulose-binding domain family III [49390] (3 proteins) |
![]() | Protein Endo/exocellulase:cellobiose E-4, C-terminal domain [49394] (2 species) |
![]() | Species Thermomonospora fusca [TaxId:2021] [49395] (4 PDB entries) |
![]() | Domain d3tf4a2: 3tf4 A:461-605 [22399] Other proteins in same PDB: d3tf4a1, d3tf4b1 |
PDB Entry: 3tf4 (more details), 2.2 Å
SCOP Domain Sequences for d3tf4a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3tf4a2 b.2.2.2 (A:461-605) Endo/exocellulase:cellobiose E-4, C-terminal domain {Thermomonospora fusca} peifveaqintpgttfteikamirnqsgwparmldkgtfrywftldegvdpaditvssay nqcatpedvhhvsgdlyyveidctgekifpggqsehrrevqfriaggpgwdpsndwsfqg ignelapapyivlyddgvpvwgtap
Timeline for d3tf4a2: