Lineage for d3tf4a2 (3tf4 A:461-605)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 161785Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (7 superfamilies)
  4. 161799Superfamily b.2.2: Carbohydrate-binding domain [49384] (3 families) (S)
  5. 161813Family b.2.2.2: Cellulose-binding domain family III [49390] (3 proteins)
  6. 161827Protein Endo/exocellulase:cellobiose E-4, C-terminal domain [49394] (1 species)
  7. 161828Species Thermomonospora fusca [TaxId:2021] [49395] (4 PDB entries)
  8. 161835Domain d3tf4a2: 3tf4 A:461-605 [22399]
    Other proteins in same PDB: d3tf4a1, d3tf4b1

Details for d3tf4a2

PDB Entry: 3tf4 (more details), 2.2 Å

PDB Description: endo/exocellulase:cellotriose from thermomonospora

SCOP Domain Sequences for d3tf4a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3tf4a2 b.2.2.2 (A:461-605) Endo/exocellulase:cellobiose E-4, C-terminal domain {Thermomonospora fusca}
peifveaqintpgttfteikamirnqsgwparmldkgtfrywftldegvdpaditvssay
nqcatpedvhhvsgdlyyveidctgekifpggqsehrrevqfriaggpgwdpsndwsfqg
ignelapapyivlyddgvpvwgtap

SCOP Domain Coordinates for d3tf4a2:

Click to download the PDB-style file with coordinates for d3tf4a2.
(The format of our PDB-style files is described here.)

Timeline for d3tf4a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3tf4a1