SCOPe 2.05: Domain d4jt8a_: 4jt8 A:

Lineage for d4jt8a_ (4jt8 A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like

4. Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (7 families)
   binds cofactor molecules in the opposite direction than classical Rossmann fold

5. Family c.31.1.0: automated matches [191352] (1 protein)
   not a true family

6. Protein automated matches [190312] (9 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [224883] (17 PDB entries)

8. Domain d4jt8a_: 4jt8 A: [223989]
   automated match to d1j8fc_
   complexed with 1nr, zn

Details for d4jt8a_

PDB Entry: 4jt8, 2.26 Å

PDB Description: Crystal Structure of human SIRT3 with ELT inhibitor 28 [4-(4-{2-[(2,2-dimethylpropanoyl)amino]ethyl}piperidin-1-yl)thieno[3,2-d]pyrimidine-6-carboxamide[

PDB Compounds: (A:) NAD-dependent protein deacetylase sirtuin-3, mitochondrial

SCOPe Domain Sequences for d4jt8a_:

Sequence; same for both SEQRES and ATOM records:

>d4jt8a_ c.31.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kgklslqdvaeliraracqrvvvmvgagistpsgipdfrspgsglysnlqqydlpypeai
felpfffhnpkpfftlakelypgnykpnvthyflrllhdkglllrlytqnidglervsgi
pasklveahgtfasatctvcqrpfpgediradvmadrvprcpvctgvvkpdivffgeplp
qrfllhvvdfpmadlllilgtslevepfaslteavrssvprllinrdlvgplawhprsrd
vaqlgdvvhgveslvellgwteemrdlvqretgk

Timeline for d4jt8a_:

• d4jt8a_ first appeared in SCOPe 2.03
  
• d4jt8a_ appears in SCOPe 2.04
  
• d4jt8a_ appears in SCOPe 2.06
  
• d4jt8a_ appears in the current release, SCOPe 2.08