Lineage for d4jshb_ (4jsh B:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1941879Fold d.174: Nitric oxide (NO) synthase oxygenase domain [56511] (1 superfamily)
    unusual fold
  4. 1941880Superfamily d.174.1: Nitric oxide (NO) synthase oxygenase domain [56512] (1 family) (S)
    automatically mapped to Pfam PF02898
  5. 1941881Family d.174.1.1: Nitric oxide (NO) synthase oxygenase domain [56513] (2 proteins)
  6. 1941882Protein Nitric oxide (NO) synthase oxygenase domain [56514] (6 species)
  7. 1942164Species Norway rat (Rattus norvegicus) [TaxId:10116] [82821] (205 PDB entries)
    Uniprot P29476 298-716
  8. 1942478Domain d4jshb_: 4jsh B: [223983]
    automated match to d1om4b_
    complexed with act, h4b, hem, q15, zn

Details for d4jshb_

PDB Entry: 4jsh (more details), 2.35 Å

PDB Description: structure of rat neuronal nitric oxide synthase heme domain in complex with 4-methyl-6-((3-(piperidin-4-ylmethoxy)phenoxy)methyl)pyridin-2- amine
PDB Compounds: (B:) Nitric oxide synthase, brain

SCOPe Domain Sequences for d4jshb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4jshb_ d.174.1.1 (B:) Nitric oxide (NO) synthase oxygenase domain {Norway rat (Rattus norvegicus) [TaxId: 10116]}
rflkvknwetdvvltdtlhlkstletgctehicmgsimlpsqhtrkpedvrtkdqlfpla
kefldqyyssikrfgskahmdrleevnkeieststyqlkdteliygakhawrnasrcvgr
iqwsklqvfdardcttahgmfnyicnhvkyatnkgnlrsaitifpqrtdgkhdfrvwnsq
liryagykqpdgstlgdpanvqfteiciqqgwkaprgrfdvlplllqangndpelfqipp
elvlevpirhpkfdwfkdlglkwyglpavsnmlleigglefsacpfsgwymgteigvrdy
cdnsrynileevakkmdldmrktsslwkdqalveiniavlysfqsdkvtivdhhsatesf
ikhmeneyrcrggcpadwvwivppmsgsitpvfhqemlnyrltpsfeyqpdpwnthvwkg

SCOPe Domain Coordinates for d4jshb_:

Click to download the PDB-style file with coordinates for d4jshb_.
(The format of our PDB-style files is described here.)

Timeline for d4jshb_: