SCOPe 2.01: Domain d4tf4b2: 4tf4 B:461-605

Lineage for d4tf4b2 (4tf4 B:461-605)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.2: Carbohydrate-binding domain [49384] (4 families)

5. Family b.2.2.2: Cellulose-binding domain family III [49390] (9 proteins)
   Pfam PF00963

6. Protein Endo/exocellulase:cellobiose E-4, C-terminal domain [49394] (2 species)

7. Species Thermobifida fusca [TaxId:2021] [49395] (4 PDB entries)

8. Domain d4tf4b2: 4tf4 B:461-605 [22398]
   Other proteins in same PDB: d4tf4a1, d4tf4b1
   complexed with ca

Details for d4tf4b2

PDB Entry: 4tf4, 2 Å

PDB Description: endo/exocellulase:cellopentaose from thermomonospora

PDB Compounds: (B:) t. fusca endo/exo-cellulase e4 catalytic domain and cellulose-binding domain

SCOPe Domain Sequences for d4tf4b2:

Sequence; same for both SEQRES and ATOM records:

>d4tf4b2 b.2.2.2 (B:461-605) Endo/exocellulase:cellobiose E-4, C-terminal domain {Thermobifida fusca [TaxId: 2021]}
peifveaqintpgttfteikamirnqsgwparmldkgtfrywftldegvdpaditvssay
nqcatpedvhhvsgdlyyveidctgekifpggqsehrrevqfriaggpgwdpsndwsfqg
ignelapapyivlyddgvpvwgtap

Timeline for d4tf4b2:

• d4tf4b2 first appeared (with stable ids) in SCOP 1.55
  
• d4tf4b2 appears in SCOP 1.75
  
• d4tf4b2 appears in SCOPe 2.02
  
• d4tf4b2 appears in the current release, SCOPe 2.08