Lineage for d4jrob_ (4jro B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2090218Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2090219Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2094257Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2094258Protein automated matches [190069] (238 species)
    not a true protein
  7. 2095276Species Listeria monocytogenes [TaxId:169963] [226203] (3 PDB entries)
  8. 2095282Domain d4jrob_: 4jro B: [223970]
    automated match to d2c07a1
    complexed with nap

Details for d4jrob_

PDB Entry: 4jro (more details), 1.92 Å

PDB Description: crystal structure of 3-oxoacyl-[acyl-carrier protein]reductase (fabg) from listeria monocytogenes in complex with nadp+
PDB Compounds: (B:) FabG protein

SCOPe Domain Sequences for d4jrob_:

Sequence, based on SEQRES records: (download)

>d4jrob_ c.2.1.0 (B:) automated matches {Listeria monocytogenes [TaxId: 169963]}
mtlqgkvavvtggsrgigrdiainlakeganiffnyngspeaaeetaklvaehgveveam
kanvaiaedvdaffkqaierfgrvdilvnnagitrdnllmrmkedewddvininlkgtfl
ctkavsrtmmkqragkiinmasvvglignagqanyvaskagvigltkttarelaprginv
navapgfittdmtdkldektkeamlaqiplgaygttedianavlflasdaskyitgqtls
vdggmvm

Sequence, based on observed residues (ATOM records): (download)

>d4jrob_ c.2.1.0 (B:) automated matches {Listeria monocytogenes [TaxId: 169963]}
mtlqgkvavvtggsrgigrdiainlakeganiffnyngspeaaeetaklvaehgveveam
kanvaiaedvdaffkqaierfgrvdilvnnagitrdnllmrmkedewddvininlkgtfl
ctkavsrtmmkqragkiinmasvvglignagqanyvaskagvigltkttarelaprginv
navapgfittdkeamlaqiplgaygttedianavlflasdaskyitgqtlsvdggmvm

SCOPe Domain Coordinates for d4jrob_:

Click to download the PDB-style file with coordinates for d4jrob_.
(The format of our PDB-style files is described here.)

Timeline for d4jrob_: