Lineage for d4tf4a2 (4tf4 A:461-605)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 938438Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 938452Superfamily b.2.2: Carbohydrate-binding domain [49384] (4 families) (S)
  5. 938466Family b.2.2.2: Cellulose-binding domain family III [49390] (9 proteins)
    Pfam PF00963
  6. 938496Protein Endo/exocellulase:cellobiose E-4, C-terminal domain [49394] (2 species)
  7. 938506Species Thermobifida fusca [TaxId:2021] [49395] (4 PDB entries)
  8. 938511Domain d4tf4a2: 4tf4 A:461-605 [22397]
    Other proteins in same PDB: d4tf4a1, d4tf4b1
    complexed with ca

Details for d4tf4a2

PDB Entry: 4tf4 (more details), 2 Å

PDB Description: endo/exocellulase:cellopentaose from thermomonospora
PDB Compounds: (A:) t. fusca endo/exo-cellulase e4 catalytic domain and cellulose-binding domain

SCOPe Domain Sequences for d4tf4a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4tf4a2 b.2.2.2 (A:461-605) Endo/exocellulase:cellobiose E-4, C-terminal domain {Thermobifida fusca [TaxId: 2021]}
peifveaqintpgttfteikamirnqsgwparmldkgtfrywftldegvdpaditvssay
nqcatpedvhhvsgdlyyveidctgekifpggqsehrrevqfriaggpgwdpsndwsfqg
ignelapapyivlyddgvpvwgtap

SCOPe Domain Coordinates for d4tf4a2:

Click to download the PDB-style file with coordinates for d4tf4a2.
(The format of our PDB-style files is described here.)

Timeline for d4tf4a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4tf4a1