SCOP 1.61: Domain d4tf4a2: 4tf4 A:461-605

Lineage for d4tf4a2 (4tf4 A:461-605)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (7 superfamilies)

4. Superfamily b.2.2: Carbohydrate-binding domain [49384] (3 families)

5. Family b.2.2.2: Cellulose-binding domain family III [49390] (3 proteins)

6. Protein Endo/exocellulase:cellobiose E-4, C-terminal domain [49394] (1 species)

7. Species Thermomonospora fusca [TaxId:2021] [49395] (4 PDB entries)

8. Domain d4tf4a2: 4tf4 A:461-605 [22397]
   Other proteins in same PDB: d4tf4a1, d4tf4b1

Details for d4tf4a2

PDB Entry: 4tf4, 2 Å

PDB Description: endo/exocellulase:cellopentaose from thermomonospora

SCOP Domain Sequences for d4tf4a2:

Sequence; same for both SEQRES and ATOM records:

>d4tf4a2 b.2.2.2 (A:461-605) Endo/exocellulase:cellobiose E-4, C-terminal domain {Thermomonospora fusca}
peifveaqintpgttfteikamirnqsgwparmldkgtfrywftldegvdpaditvssay
nqcatpedvhhvsgdlyyveidctgekifpggqsehrrevqfriaggpgwdpsndwsfqg
ignelapapyivlyddgvpvwgtap

Timeline for d4tf4a2:

• d4tf4a2 first appeared (with stable ids) in SCOP 1.55
  
• d4tf4a2 appears in SCOP 1.59
  
• d4tf4a2 appears in SCOP 1.63
  
• d4tf4a2 appears in the current release, SCOPe 2.08